DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-1 and BDH1

DIOPT Version :9

Sequence 1:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_009341.2 Gene:BDH1 / 851239 SGDID:S000000056 Length:382 Species:Saccharomyces cerevisiae


Alignment Length:373 Identity:105/373 - (28%)
Similarity:175/373 - (46%) Gaps:46/373 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LHGIEDMRLEQRPIPEI-ADDEVLLAMDSVGICGSDVHYLAHG-----------RIGDFVLTKPM 62
            :|...|:     |.||| .||||::.:...||||||:|....|           ::.:..|  |:
Yeast    12 IHFTNDI-----PRPEIQTDDEVIIDVSWCGICGSDLHEYLDGPIFMPKDGECHKLSNAAL--PL 69

  Fly    63 IIGHESAGVVAKLGKKVTTLKVGDRVAIEPGVPC--------------RKCDHCKQGKYNLCPGM 113
            .:|||.:|:|:|:|.|||.:||||.|.::....|              :.||.|::|..|||...
Yeast    70 AMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHA 134

  Fly   114 VFCATPPYDGNLTRYYKHAADFCFKLPDHVTMEEGALLEPLSVGVHACKRAEVTLGSKVLILGAG 178
            .|.......|........:......:|..:.::..||:|||||..||.|.:....||..|:||||
Yeast   135 GFVGLGVISGGFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAG 199

  Fly   179 PIGLVTLMAAQAMGASEILITDLVQQRLDVAKELGATHTLLLKRDQTAEETAVLVQKTMGGQPDK 243
            ||||.|::..:.||||:|:::::.::|:::||:||.......|....:.|....:.|:..|. |.
Yeast   200 PIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEILRGLTKSHDGF-DY 263

  Fly   244 SIDCCGA----ESSARLAIFATRSGGIVVVVGMGAAEIKLPLINALAREVDIRGVFRY-CNDYAA 303
            |.||.|.    |:|.:...|...:..|.|   .|...:....::...:|..:.|...| ..|:..
Yeast   264 SYDCSGIQVTFETSLKALTFKGTATNIAV---WGPKPVPFQPMDVTLQEKVMTGSIGYVVEDFEE 325

  Fly   304 ALALVASGKV---NVKRLVTHHFDIKE-TAKAFETSRKGLGGAIKVMI 347
            .:..:.:|.:   :.|:|:|....|:: ..|.|:.........:|:::
Yeast   326 VVRAIHNGDIAMEDCKQLITGKQRIEDGWEKGFQELMDHKESNVKILL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 105/370 (28%)
sorbitol_DH 8..349 CDD:176188 105/373 (28%)
BDH1NP_009341.2 butanediol_DH_like 1..374 CDD:176195 105/373 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343130
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S593
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X751
TreeFam 1 0.960 - -
65.650

Return to query results.
Submit another query.