DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-1 and BDH2

DIOPT Version :9

Sequence 1:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_009340.1 Gene:BDH2 / 851238 SGDID:S000000057 Length:417 Species:Saccharomyces cerevisiae


Alignment Length:385 Identity:110/385 - (28%)
Similarity:174/385 - (45%) Gaps:68/385 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IADDEVLLAMDSVGICGSDVHYLAHG-----------RIGDFVLTKPMIIGHESAGVVAKLGKKV 79
            :|.||:::.::..||||:|:|....|           .|....|  |..:|||.||.|.::|..|
Yeast    24 VAPDELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPL--PQAMGHEMAGTVLEVGPGV 86

  Fly    80 TTLKVGDRVAIEPGVPCRK--------------CDHCKQGKYNLCPGMVFCATPPYDGNLTRYYK 130
            ..|||||:|.:||...||.              |..||:|.||:|..:..|......|.......
Yeast    87 KNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNICSYLGLCGAGVQSGGFAERVV 151

  Fly   131 HAADFCFKLPDHVTMEEGALLEPLSVGVHACKRAEVTLGSKVLILGAGPIGLVTLMAAQAMGASE 195
            .....|:|:||.|.::..||::||:|..||.:..|...||..||:|||||||.|::|..|.|..:
Yeast   152 MNESHCYKVPDFVPLDVAALIQPLAVCWHAIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKD 216

  Fly   196 ILITDLVQQRLDVAKELGATHTLLLKRDQTA----EETAVLVQKTMGGQP-DKSIDCCGAESSAR 255
            |::::..:.|.::|:::||.     ..|.||    |....|.....||.. |.:.||.|.|.:..
Yeast   217 IVVSEPAKVRRELAEKMGAR-----VYDPTAHAAKESIDYLRSIADGGDGFDYTFDCSGLEVTLN 276

  Fly   256 LAIFATRSGGIVVVVGM-GAAEIKLPLINALAREVDIRGVFRYC-NDYAAALALVASGKVNVKR- 317
            .||......|..|.:.| |..:|:...::....|....|...|. :|:.|.:..:..|::::.| 
Yeast   277 AAIQCLTFRGTAVNLAMWGHHKIQFSPMDITLHERKYTGSMCYTHHDFEAVIEALEEGRIDIDRA 341

  Fly   318 --LVTHHFDIKETAKAFETSRKGLGGAIKVMIHVQP----------------RDTNNPRK 359
              ::|...:|::          ||.|||..:|:.:.                |:.:|.:|
Yeast   342 RHMITGRVNIED----------GLDGAIMKLINEKESTIKIILTPNNHGELNREADNEKK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 106/354 (30%)
sorbitol_DH 8..349 CDD:176188 107/357 (30%)
BDH2NP_009340.1 butanediol_DH_like 1..375 CDD:176195 107/367 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S593
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100349
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X751
TreeFam 1 0.960 - -
76.550

Return to query results.
Submit another query.