DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-1 and YLR460C

DIOPT Version :9

Sequence 1:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_013565.3 Gene:YLR460C / 851182 SGDID:S000004452 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:193 Identity:43/193 - (22%)
Similarity:71/193 - (36%) Gaps:64/193 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DNLTAVLHGIEDMRL---EQRPIPEIADDEVLLAMDSVGICGSDVHYLAH--GRIGDFVLTKPMI 63
            :.:.||:  |||.:.   |..||||:.:..||:  .::.:.|:...: ||  .:||    .:..|
Yeast     7 ETMKAVV--IEDGKAVVKEGIPIPELEEGFVLI--KTLAVAGNPTDW-AHIDYKIG----PQGSI 62

  Fly    64 IGHESAGVVAKLGKKVT--TLKVGDRVAIEPGVPCRKCDHCKQGKYNLCPGMVFCATPPYDGNLT 126
            :|.::||.:.|||..|.  ...:||.:                  |....|.  ....|.:|...
Yeast    63 LGCDAAGQIVKLGPAVNPKDFSIGDYI------------------YGFIHGS--SVRFPSNGAFA 107

  Fly   127 RYYKHAADFCFKLPDHVTMEEGALLEPLSVGVHACKRAEVTLGSKVLILGAGPI----GLVTL 185
            .|...:....:|.|:.:..                      ||..|  |.|||:    |:.|:
Yeast   108 EYSAISTVVAYKSPNELKF----------------------LGEDV--LPAGPVRSLEGVATI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 43/193 (22%)
sorbitol_DH 8..349 CDD:176188 43/189 (23%)
YLR460CNP_013565.3 enoyl_reductase_like 9..375 CDD:176211 43/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.