DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-1 and ADH7

DIOPT Version :9

Sequence 1:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_010030.1 Gene:ADH7 / 850469 SGDID:S000000702 Length:361 Species:Saccharomyces cerevisiae


Alignment Length:359 Identity:87/359 - (24%)
Similarity:152/359 - (42%) Gaps:93/359 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTKPMIIGHESAGVVAKLGKKV-TTLKVG 85
            |.| ..|.:|.:.:::.||||||.| :|.|..|.  :.:..|:|||..|.|.|:|.|. |.:|:|
Yeast    28 PKP-FGDHDVDVEIEACGICGSDFH-IAVGNWGP--VPENQILGHEIIGRVVKVGSKCHTGVKIG 88

  Fly    86 DRVAI-EPGVPCRKCDHCKQGKYNLCPG--MVFCATPPYDGNLT--------RYYKHAADFCFKL 139
            |||.: ...:.|.:|:.||......|..  ::...||..||.::        |.::|   |..::
Yeast    89 DRVGVGAQALACFECERCKSDNEQYCTNDHVLTMWTPYKDGYISQGGFASHVRLHEH---FAIQI 150

  Fly   140 PDHVTMEEGALLEPLSVGVHACKRAEVTL-----------GSKVLILGAGPIGLVTLMAAQAMGA 193
            |:::   ...|..||..|       .:|:           |.:|.|:|.|.||.:.::.|:||||
Yeast   151 PENI---PSPLAAPLLCG-------GITVFSPLLRNGCGPGKRVGIVGIGGIGHMGILLAKAMGA 205

  Fly   194 SEILITDLVQQRLDVAKELGATHTLLLKRDQ--TAEETAVLVQKTMGGQPDKSIDCCGAESSARL 256
             |:........:.:.:.:|||.|.:.:..|:  |.:.:..|         |..:.|..:.|....
Yeast   206 -EVYAFSRGHSKREDSMKLGADHYIAMLEDKGWTEQYSNAL---------DLLVVCSSSLSKVNF 260

  Fly   257 AIFATRSGGIVVVVGMGAAEIKLPLINALAREVDIRGVFRYCNDYAAALALVASG---------- 311
                   ..||.::.:|.:     :::..|.||:.:.|.:.......:::..|.|          
Yeast   261 -------DSIVKIMKIGGS-----IVSIAAPEVNEKLVLKPLGLMGVSISSSAIGSRKEIEQLLK 313

  Fly   312 -------KVNVKRL------VTHHF------DIK 326
                   |:.|::|      |:|.|      |:|
Yeast   314 LVSEKNVKIWVEKLPISEEGVSHAFTRMESGDVK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 87/359 (24%)
sorbitol_DH 8..349 CDD:176188 87/359 (24%)
ADH7NP_010030.1 CAD1 8..353 CDD:176186 87/359 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.