DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-1 and Fdh

DIOPT Version :9

Sequence 1:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_524310.1 Gene:Fdh / 41311 FlyBaseID:FBgn0011768 Length:379 Species:Drosophila melanogaster


Alignment Length:383 Identity:96/383 - (25%)
Similarity:155/383 - (40%) Gaps:94/383 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IEDMRLEQRPIPEIAD---DEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK-------PMIIGHE 67
            |||:        |:|.   .||.:.:.:.|:|.:|.          |.|:.       |:::|||
  Fly    25 IEDI--------EVAPPKAHEVRIKITATGVCHTDA----------FTLSGADPEGLFPVVLGHE 71

  Fly    68 SAGVVAKLGKKVTTLKVGDRVAIEPGVP-CRKCDHCKQGKYNLC--------PGMV--------- 114
            .||:|..:|:.||..|.||.| |...:| |.:|..||.||.|||        .|::         
  Fly    72 GAGIVESVGEGVTNFKAGDHV-IALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEGTSRLSC 135

  Fly   115 -------FCATPPYDGNLTRYYKHAADFCF-KLPDHVTMEEGALLE-PLSVGVHAC-KRAEVTLG 169
                   |..|..:     ..|...||... |:.:...:|:..||. .:|.|..|. ..|:|..|
  Fly   136 KGQQLFHFMGTSTF-----AEYTVVADISLTKINEKAPLEKVCLLGCGISTGYGAALNTAKVEAG 195

  Fly   170 SKVLILGAGPIGLVTLMAAQAMGASEILITDLVQQRLDVAKELGATHTLLLKRDQTAEETAV--- 231
            |...:.|.|.:||...:..:..||.:|...|:...:.::||:.|.|.  .:.....|::.::   
  Fly   196 STCAVWGLGAVGLAVGLGCKKAGAGKIYGIDINPDKFELAKKFGFTD--FVNPKDVADKGSIQNY 258

  Fly   232 LVQKTMGGQPDKSIDCCGAESSARLAIFATRSG-GIVVVVGMGAAEIKLPLINALAREVDIR--- 292
            |:..|.||. |.:.:|.|..::.|.|:.||..| |..||:|:..|          .:|:..|   
  Fly   259 LIDLTDGGF-DYTFECIGNVNTMRSALEATHKGWGTSVVIGVAGA----------GQEISTRPFQ 312

  Fly   293 ------------GVFRYCNDYAAALALVASGKVNVKRLVTHHFDIKETAKAFETSRKG 338
                        |.:|..:|....:.......:.|...:||...:.:..:||:...||
  Fly   313 LVVGRVWKGSAFGGWRSVSDVPKLVEDYLKKDLLVDEFITHELPLSQINEAFDLMHKG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 96/383 (25%)
sorbitol_DH 8..349 CDD:176188 96/383 (25%)
FdhNP_524310.1 FrmA 9..379 CDD:223990 96/383 (25%)
alcohol_DH_class_III 9..378 CDD:176260 96/383 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.