DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-1 and sodh-2

DIOPT Version :9

Sequence 1:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_505992.1 Gene:sodh-2 / 179628 WormBaseID:WBGene00010791 Length:351 Species:Caenorhabditis elegans


Alignment Length:330 Identity:82/330 - (24%)
Similarity:133/330 - (40%) Gaps:63/330 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MRLEQRPIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK--PMIIGHESAGVVAKLGKK 78
            :.:.|..:|:..::|:|:.::..|||.||:|...    |||....  |:|.|||.||.|..:|.|
 Worm    22 LEVRQVSVPQPQENELLVKIEYSGICHSDLHTWE----GDFEYASICPLIGGHEGAGTVVTIGSK 82

  Fly    79 VTTLKVGDRVAIE-PGVPCRKCDHCKQGKYNLCPGMVFCATPPYDGNLTRYYKHAADFCFKLPDH 142
            |....:|||..|: ....|..|::||.|...||                   .|..:  :.:..|
 Worm    83 VKGWNIGDRAGIKLINANCLNCEYCKTGHEPLC-------------------DHIQN--YGIDRH 126

  Fly   143 VTMEE------------------GALLEPLSVGVHACKRAEVT---LGSKVLILGA-GPIGLVTL 185
            .|.:|                  .|....|..||.|.|..:.|   .|..|::.|| |.:|...:
 Worm   127 GTFQEYLTIRDIDAIKVSNDTNLAAAAPVLCGGVTAYKSLKATNVKPGQIVVLTGAGGGLGSFGI 191

  Fly   186 MAAQAMGASEILITDLVQQRLDVAKELGATHTLLLKRDQTAEETAVLV---QKTMGGQPDKSIDC 247
            ..|:|||...:.:..:.::  |..:.|||...:      .|.:|..:|   :|...|.....:..
 Worm   192 QYAKAMGMRVVAVDHISKE--DHCRNLGAEWFV------DAFDTPDIVAHIRKLTNGGAHGVVSF 248

  Fly   248 CGAESSARLAIFATRSGGIVVVVGMGA-AEIKLPLINALAREVDIRG-VFRYCNDYAAALALVAS 310
            ..|:.....|:...|..|.||.||:.. ..|.|..::.:..|:.::| :.....|...|:..:..
 Worm   249 AAAKKPMEYALEYVRKRGTVVFVGLPKDGTIPLDTLSLICNEITVKGSIVGSRMDVDEAIDFITR 313

  Fly   311 GKVNV 315
            |.|:|
 Worm   314 GIVHV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 82/330 (25%)
sorbitol_DH 8..349 CDD:176188 82/330 (25%)
sodh-2NP_505992.1 AdhP 7..349 CDD:223992 82/330 (25%)
CAD3 10..348 CDD:176257 82/330 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D605481at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.