DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and YOX1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 / 854981 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:115 Identity:33/115 - (28%)
Similarity:53/115 - (46%) Gaps:21/115 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 QHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLE-LEKEFHFNRYLTRRRR 327
            |.|.|.:.|...:    :||           ..|||.|   |..|.|. |:.||......::.:|
Yeast   160 QETFPKKEPKIDN----APL-----------ARRKRRR---TSSQELSILQAEFEKCPAPSKEKR 206

  Fly   328 IEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSP 377
            ||:|.:..:||:.::|||||:|...|::.....:  |......::||:.|
Yeast   207 IELAESCHMTEKAVQIWFQNKRQAVKRQRIATSK--STTIIQTVSPPSPP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 10/41 (24%)
Homeobox 301..354 CDD:395001 19/53 (36%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 33/115 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 1 1.000 - - X14
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.