DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and YHP1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:40/191 - (20%)
Similarity:75/191 - (39%) Gaps:29/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPD--VTEVHQNHHNMGMYQQQSGV 237
            |:..||..||.:| ..:...||   .:..|: :|.......|.  |....|...:|..|::.:.:
Yeast    69 PKRKSPQAVDFLS-QRVTTSMT---PLSKPK-KLSSHSPFTPTVRVCSKEQPPQSMHSYKKVNIL 128

  Fly   238 PPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGM---PSPLYPWMRSQFGKCQERKR 299
            .|:.|....:                  ||.::....:|...   ....:|....:....:..:|
Yeast   129 TPLSAAKAVL------------------TPTTRKEKKRSFAFITHSQETFPKKEPKIDNARLARR 175

  Fly   300 GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKG 360
            .|:..:.|:...|:..|.......:.:|||::....::|:.::|||||:|...|| :|..|
Yeast   176 KRRRTSSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKK-HKNSG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 23/135 (17%)
Homeobox 301..354 CDD:395001 14/52 (27%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 25/132 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.