DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and RAX2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_116142.1 Gene:RAX2 / 84839 HGNCID:18286 Length:184 Species:Homo sapiens


Alignment Length:112 Identity:34/112 - (30%)
Similarity:57/112 - (50%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 PSQNPNSQSSGM-PSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIA 331
            |.:.|.::..|: |....|        .::.:|.|.|:|.||..:||:.|..:.|.....|.|:|
Human     5 PGEGPATEGGGLGPGEEAP--------KKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELA 61

  Fly   332 HALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSPQ 378
            ..:.|.|.::::||||||.||:::.:.  |.|||.    :..|..|:
Human    62 AKVHLPEVRVQVWFQNRRAKWRRQERL--ESGSGA----VAAPRLPE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 8/38 (21%)
Homeodomain 298..354 CDD:459649 23/55 (42%)
RAX2NP_116142.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 7/35 (20%)
Homeodomain 28..84 CDD:459649 23/55 (42%)

Return to query results.
Submit another query.