DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and ATHB13

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 / 843314 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana


Alignment Length:123 Identity:37/123 - (30%)
Similarity:50/123 - (40%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 HPGQHTPPSQNPNSQSSGMPSPLYPW-----MRSQFGKCQERKRG-------------------R 301
            ||  |..||..|...|..:|..|:.:     .||....|.:.:.|                   :
plant    24 HP--HQSPSLAPLLPSCSLPQDLHGFASFLGKRSPMEGCCDLETGNNMNGEEDYSDDGSQMGEKK 86

  Fly   302 QTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359
            :.....|...|||.|.....|...|::::|.||.|..|||.|||||||.:||.:...|
plant    87 RRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 13/68 (19%)
Homeodomain 298..354 CDD:459649 23/74 (31%)
ATHB13NP_177136.1 Homeodomain 85..138 CDD:459649 21/52 (40%)
HALZ 140..181 CDD:460477 1/5 (20%)

Return to query results.
Submit another query.