DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and AtHB23

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:154 Identity:41/154 - (26%)
Similarity:56/154 - (36%) Gaps:62/154 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 QNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQ---GHPGQHTPPSQNPNSQSSGMPSPLY 284
            ||||                      .:.:..||:.|   |..|:.:|                 
plant    18 QNHH----------------------QEEEDHPQLLQDFHGFLGKRSP----------------- 43

  Fly   285 PWMRSQFGKCQERKRGRQTYT----------RYQTLE----LEKEFHFNRYLTRRRRIEIAHALC 335
              |.:..|.|.....|.:.|:          |...:|    |||:|.....|...|::|:|.||.
plant    44 --MNNVQGFCNLDMNGDEEYSDDGSKMGEKKRRLNMEQLKALEKDFELGNKLESDRKLELARALG 106

  Fly   336 LTERQIKIWFQNRRMKWKKENKTK 359
            |..|||.|||||||.:    :|||
plant   107 LQPRQIAIWFQNRRAR----SKTK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 15/95 (16%)
Homeodomain 298..354 CDD:459649 25/69 (36%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 23/56 (41%)
HALZ 126..167 CDD:460477 1/1 (100%)

Return to query results.
Submit another query.