DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HB53

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_201471.1 Gene:HB53 / 836803 AraportID:AT5G66700 Length:228 Species:Arabidopsis thaliana


Alignment Length:64 Identity:24/64 - (37%)
Similarity:32/64 - (50%) Gaps:5/64 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 GKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 355
            |..::||     .|..|...||..|.....|...|:.:||..|.|..||:.:||||||.:||.:
plant    68 GMLRKRK-----LTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 3/13 (23%)
Homeodomain 298..354 CDD:459649 21/55 (38%)
HB53NP_201471.1 Homeodomain 71..125 CDD:459649 22/58 (38%)

Return to query results.
Submit another query.