| Sequence 1: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_201334.1 | Gene: | HB5 / 836656 | AraportID: | AT5G65310 | Length: | 312 | Species: | Arabidopsis thaliana |
| Alignment Length: | 46 | Identity: | 21/46 - (45%) |
|---|---|---|---|
| Similarity: | 28/46 - (60%) | Gaps: | 0/46 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 308 QTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | |
| Homeodomain | 298..354 | CDD:459649 | 21/46 (46%) | ||
| HB5 | NP_201334.1 | Homeodomain | 72..125 | CDD:459649 | 19/44 (43%) |
| HALZ | 127..168 | CDD:460477 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||