DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HB5

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_201334.1 Gene:HB5 / 836656 AraportID:AT5G65310 Length:312 Species:Arabidopsis thaliana


Alignment Length:46 Identity:21/46 - (45%)
Similarity:28/46 - (60%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 QTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353
            |...|||.|..:..|...|::::|..|.|..||:.|||||||.:||
plant    80 QVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360
Homeodomain 298..354 CDD:459649 21/46 (46%)
HB5NP_201334.1 Homeodomain 72..125 CDD:459649 19/44 (43%)
HALZ 127..168 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.