DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HB51

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:53 Identity:20/53 - (37%)
Similarity:30/53 - (56%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353
            ::..|..|...||:.|.....|...|:::::..|.|..|||.:||||||.:||
plant    78 KKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 0/4 (0%)
Homeodomain 298..354 CDD:459649 20/53 (38%)
HB51NP_195999.2 Homeodomain 77..130 CDD:459649 18/51 (35%)
HALZ 132..166 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.