DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HB-3

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:180 Identity:47/180 - (26%)
Similarity:68/180 - (37%) Gaps:46/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 MNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQN--HHNMGMYQQQSGVP-PVGAP--PQGMMHQ 250
            :..:|..|.|        |:.      ..::|::  ||          :| |...|  |..:.:.
plant    18 LRLEMAFPQH--------GFM------FQQLHEDNAHH----------LPSPTSLPSCPPHLFYG 58

  Fly   251 GQGPPQMHQG----------HPGQHTP-PSQNPNSQSS-GMPSPLYPWMRSQFGKCQERKRGRQT 303
            |.|...|::.          |..|.:| .:.|.|.|.. |....|     |..|........::.
plant    59 GGGNYMMNRSMSFTGVSDHHHLTQKSPTTTNNMNDQDQVGEEDNL-----SDDGSHMMLGEKKKR 118

  Fly   304 YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353
            ....|...|||.|.....|...|::::|.||.|..|||.|||||||.:||
plant   119 LNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 24/131 (18%)
Homeobox 301..354 CDD:395001 23/53 (43%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 21/52 (40%)
HALZ 170..208 CDD:280364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.