DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HB16

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:114 Identity:31/114 - (27%)
Similarity:46/114 - (40%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 QNPNSQSSGMPSPL------------YPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYL 322
            |:|....|...|.|            |.......|..::::|.:..    |...|||.|.....|
plant    21 QSPRGYGSNYQSMLEGYDEDATLIEEYSGNHHHMGLSEKKRRLKVD----QVKALEKNFELENKL 81

  Fly   323 TRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEI 371
            ...|:.::|..|.|..||:.:||||||.:||.:...|......|:.|.:
plant    82 EPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKGQYDSL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 8/47 (17%)
Homeobox 301..354 CDD:395001 19/52 (37%)
HB16NP_195716.1 Homeobox 59..112 CDD:395001 19/56 (34%)
HALZ 114..155 CDD:396657 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.