DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HB-2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:108 Identity:29/108 - (26%)
Similarity:48/108 - (44%) Gaps:22/108 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 PPS-QNPNSQSSGMPSPLYPWMRSQFGKCQERK--------------------RGRQTYTRYQTL 310
            ||| .....:.:|:.|| ...:.|..||..||:                    |.:...::.|:.
plant    76 PPSTAEYGDEDAGVSSP-NSTVSSSTGKRSEREEDTDPQGSRGISDDEDGDNSRKKLRLSKDQSA 139

  Fly   311 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353
            .||:.|..:..|..:::..:|..|.|..||:::||||||.:.|
plant   140 ILEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 12/59 (20%)
Homeodomain 298..354 CDD:459649 18/76 (24%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:461370 10/31 (32%)
HOX 128..182 CDD:197696 17/53 (32%)
HALZ 184..227 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.