DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HAT3

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:62 Identity:20/62 - (32%)
Similarity:35/62 - (56%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 GKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353
            |...:..|.:...::.|.|.||:.|..:..|..::::.:|..|.|..||:::||||||.:.|
plant   154 GNGDDSSRKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 2/13 (15%)
Homeodomain 298..354 CDD:459649 19/56 (34%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:461370
Homeodomain 161..215 CDD:459649 18/53 (34%)
HALZ 217..260 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.