DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HB20

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:37 Identity:12/37 - (32%)
Similarity:21/37 - (56%) Gaps:6/37 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QNPSSQHVQNLQTFFH--SWPSHF---AYSLPSDQQN 44
            |||::.: :.|...|:  :.||::   ||:|..|..|
plant   205 QNPTNGN-ETLAQVFNGTAKPSNWLTPAYNLSDDPSN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360
Homeodomain 298..354 CDD:459649
HB20NP_186771.1 Homeodomain 87..140 CDD:459649
HALZ 142..183 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.