DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HB4

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_182018.1 Gene:HB4 / 819100 AraportID:AT2G44910 Length:318 Species:Arabidopsis thaliana


Alignment Length:57 Identity:21/57 - (36%)
Similarity:35/57 - (61%) Gaps:2/57 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353
            ||:.|  .::.|.|.||:.|..:..|..::::.:|..|.|..||:::||||||.:.|
plant   162 RKKLR--LSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 3/8 (38%)
Homeodomain 298..354 CDD:459649 20/56 (36%)
HB4NP_182018.1 HD-ZIP_N 8..124 CDD:461370
Homeodomain 162..216 CDD:459649 20/55 (36%)
HALZ 218..261 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.