DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HB21

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_179445.1 Gene:HB21 / 816370 AraportID:AT2G18550 Length:220 Species:Arabidopsis thaliana


Alignment Length:138 Identity:36/138 - (26%)
Similarity:56/138 - (40%) Gaps:28/138 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 HQN--HHNMGMYQQQSGVPPVGAP--PQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSP 282
            :||  .||:.:..|.  .|.|..|  ||   ..|:..|...:....:....::...::.:|    
plant     3 NQNVDDHNLLLISQL--YPNVYTPLVPQ---QGGEAKPTRRRKRKSKSVVVAEEGENEGNG---- 58

  Fly   283 LYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN 347
               |.|       :||...:     |...||..|..:..|...|:..:|..|.|..||:.:||||
plant    59 ---WFR-------KRKLSDE-----QVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQN 108

  Fly   348 RRMKWKKE 355
            ||.:||.:
plant   109 RRARWKNK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 17/87 (20%)
Homeodomain 298..354 CDD:459649 19/55 (35%)
HB21NP_179445.1 HOX 61..114 CDD:197696 20/64 (31%)

Return to query results.
Submit another query.