DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa5

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_077365.1 Gene:Hoxa5 / 79241 RGDID:620609 Length:381 Species:Rattus norvegicus


Alignment Length:373 Identity:117/373 - (31%)
Similarity:147/373 - (39%) Gaps:126/373 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNAN-----------HQGNMPY 57
            ||:..:.|:|||.||:.      |.|| ||    ...|:|:|..:::           |.|...|
  Rat   105 STHIKKQMSSYFVNSFC------GRYP-NG----PDYQLHNYGDHSSVSEQFRDSASMHSGRYGY 158

  Fly    58 PRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQN 122
            .          |||..:                 .||     ...:|..|..::.:         
  Rat   159 G----------YNGMDL-----------------SVG-----RSGSGHFGSGERAR--------- 182

  Fly   123 QQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMS 187
            .....|..||.:     |:.:|..|........|:   .|.        .:.|..||       .
  Rat   183 SYAAGASAAPAE-----PRYSQPATSTHSPPPDPL---PCS--------AVAPSPGS-------D 224

  Fly   188 GHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQ 252
            .|| ..:.:|.:..| ..|..|.|.:                  ..:.||....|..:      .
  Rat   225 SHH-GGKNSLGNSSG-ASANAGSTHI------------------SSREGVGTASAAEE------D 263

  Fly   253 GPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMR------SQFGKCQERKRGRQTYTRYQTLE 311
            .|....|.  |..:.||..|.:|..     :|||||      ...|. .|.||.|..||||||||
  Rat   264 APASSEQA--GAQSEPSPAPPAQPQ-----IYPWMRKLHISHDNIGG-PEGKRARTAYTRYQTLE 320

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359
            |||||||||||||||||||||||||:|||||||||||||||||:||.|
  Rat   321 LEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 32/150 (21%)
Homeobox 301..354 CDD:395001 49/52 (94%)
Hoxa5NP_077365.1 Homeobox 310..363 CDD:365835 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.