DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and lbx1

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001072559.1 Gene:lbx1 / 780014 XenbaseID:XB-GENE-6455157 Length:265 Species:Xenopus tropicalis


Alignment Length:68 Identity:29/68 - (42%)
Similarity:42/68 - (61%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 FGKCQ---ERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 352
            ||:.|   :|::.|..:|.:|..||||.|.:.:||:...|.:||..|.||..|:..||||||.|.
 Frog   116 FGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKL 180

  Fly   353 KKE 355
            |::
 Frog   181 KRD 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 5/17 (29%)
Homeodomain 298..354 CDD:459649 24/55 (44%)
lbx1NP_001072559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
Homeodomain 126..182 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..265
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.