DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hmx4

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001038836.2 Gene:hmx4 / 751654 ZFINID:ZDB-GENE-060825-142 Length:238 Species:Danio rerio


Alignment Length:84 Identity:32/84 - (38%)
Similarity:46/84 - (54%) Gaps:11/84 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 KCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK 357
            |...:|:.|..:::.|..:||..|...|||:...|..:|::|.|||.|:||||||||.|.|::..
Zfish   108 KLMTKKKTRTIFSKRQIFQLESTFDMKRYLSSAERACLANSLQLTETQVKIWFQNRRNKLKRQLS 172

  Fly   358 TKGEPGSGGEGDEITPPNS 376
            |           |:..|||
Zfish   173 T-----------ELEGPNS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 3/12 (25%)
Homeodomain 298..354 CDD:459649 25/55 (45%)
hmx4NP_001038836.2 Homeodomain 115..169 CDD:459649 24/53 (45%)

Return to query results.
Submit another query.