DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and gsx1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:212 Identity:61/212 - (28%)
Similarity:81/212 - (38%) Gaps:57/212 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 VHQNHHNMGM-----YQQQSGV---------------PPVGAPPQGMMHQGQGPPQMHQGHPGQH 265
            ||..|...|:     :.::||:               ||.|.|.........|......|...||
 Frog    31 VHPTHPLHGLPAGSCHSRKSGLLCVCPMCVTASHLHPPPPGIPLLKASFSSFGTQYCPAGLGRQH 95

  Fly   266 TPPSQNPNSQSSGMPSPLYPW----------MRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNR 320
            :..:....|....:....||.          :.|...:....||.|..:|..|.||||:||..|.
 Frog    96 SASTGINVSHGPALYQAAYPLPDPRQFHCISVDSSPSQLSSSKRMRTAFTSTQLLELEREFASNM 160

  Fly   321 YLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKG------------------------- 360
            ||:|.||||||..|.|:|:|:||||||||:|.|||.|:..                         
 Frog   161 YLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSSTHRASPHGCKCSSLSSKCLEEDDEDL 225

  Fly   361 --EPGSGGEGDEITPPN 375
              .|.|.|:.|....|:
 Frog   226 AMSPSSSGKDDRDLSPS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 21/114 (18%)
Homeobox 301..354 CDD:395001 32/52 (62%)
gsx1NP_001039254.1 homeobox 137..196 36/58 (62%)
Homeobox 141..194 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.