DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa6

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:144 Identity:79/144 - (54%)
Similarity:91/144 - (63%) Gaps:16/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 GAPPQGMMHQGQGP-PQMHQGHPGQHTPPSQNPNSQS-------SGMPSPLYPWMRSQFGKC--- 294
            ||.|.|...| :|| ..:|.....|:.|.|.:...::       ....||:||||: :...|   
  Rat    87 GASPSGNSKQ-RGPGDYLHFSPEQQYKPDSSSVQGKALHEEGTDRKYTSPVYPWMQ-RMNSCAGA 149

  Fly   295 ---QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN 356
               ...:|||||||||||||||||||||||||||||||||:||||||||||||||||||||||||
  Rat   150 VYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKEN 214

  Fly   357 KTKGEPGSGGEGDE 370
            |......:.||..|
  Rat   215 KLINSTQASGEDSE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 24/78 (31%)
Homeobox 301..354 CDD:395001 51/52 (98%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 51/52 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.