DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Isx

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001387929.1 Gene:Isx / 682968 RGDID:1592776 Length:242 Species:Rattus norvegicus


Alignment Length:78 Identity:33/78 - (42%)
Similarity:46/78 - (58%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 QERK---RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN 356
            :|||   |.|.|:|..|..||||.|||..|.....|.::|..:.|.|.:::|||||:|.||:|:.
  Rat    73 EERKNKRRVRTTFTTEQLQELEKLFHFTHYPDIHVRSQLASRINLPEARVQIWFQNQRAKWRKQE 137

  Fly   357 KTKG-----EPGS 364
            |:..     :|||
  Rat   138 KSGSLSAPQQPGS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 6/13 (46%)
Homeodomain 298..354 CDD:459649 26/58 (45%)
IsxNP_001387929.1 Homeodomain 79..135 CDD:459649 25/55 (45%)

Return to query results.
Submit another query.