DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and DRGX

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_011538391.1 Gene:DRGX / 644168 HGNCID:21536 Length:298 Species:Homo sapiens


Alignment Length:125 Identity:36/125 - (28%)
Similarity:54/125 - (43%) Gaps:42/125 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 QERKRGRQTYTRYQTLELEKEF---HFNRYLTRRR----------RIEIAHALCLTERQI----- 341
            ::::|.|.|:|..|...||..|   |:....||..          |:::|::...||.||     
Human    31 RKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQLANSCLKTELQIEINDT 95

  Fly   342 -----------------KIWFQNRRMKWKKENK--TKGEPGSGGEGDEITPP-----NSP 377
                             ::||||||.||:|..:  :..|||:.....|:|||     |||
Human    96 IIEHSEVEDHNFSLKGARVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 3/10 (30%)
Homeodomain 298..354 CDD:459649 25/90 (28%)
DRGXXP_011538391.1 Homeodomain 34..125 CDD:459649 25/90 (28%)
OAR 236..253 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.