DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxb6b

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:227 Identity:88/227 - (38%)
Similarity:109/227 - (48%) Gaps:51/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 MSGHHMNA--QMTLP----HHMGH-PQAQLGYTD------VGVPDVTEVHQNHHNMGMYQQQSGV 237
            ||.:.:|:  .::||    ..:|. |....||||      ......|.|....:....|||..||
Zfish     1 MSSYFVNSTFPVSLPGGQESFLGQIPLYSSGYTDSLRHYPSATFGATNVQDKVYTSSYYQQAGGV 65

  Fly   238 --------------P----------PVGAPPQGM-MHQGQGPPQMHQGHPGQHTPPSQNPNSQSS 277
                          |          .:|:....: :.|.|......:....::......|     
Zfish    66 FGRSGSTSACDYSTPNIYRSADRSCAIGSLEDSLVLTQDQCKTDCTEQGTERYFSTEDKP----- 125

  Fly   278 GMPSPLYPWMRSQFGKC-----QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLT 337
              .:|:||||: :...|     ...:||||||||:|||||||||||||||||||||||:||||||
Zfish   126 --CTPVYPWMQ-RMNSCNGMPGSTGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLT 187

  Fly   338 ERQIKIWFQNRRMKWKKENKTKGEPGSGGEGD 369
            ||||||||||||||||||||.........|.|
Zfish   188 ERQIKIWFQNRRMKWKKENKAVNSAKVSDEED 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/162 (22%)
Homeobox 301..354 CDD:395001 50/52 (96%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134 3/4 (75%)
Homeobox 151..203 CDD:278475 49/51 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm25055
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.