DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxa4a

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571610.1 Gene:hoxa4a / 58050 ZFINID:ZDB-GENE-000823-4 Length:245 Species:Danio rerio


Alignment Length:217 Identity:80/217 - (36%)
Similarity:99/217 - (45%) Gaps:58/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 EGGSPPLVDQMSGHHMNAQMTL-------------PHH-------MGHPQAQLGYTDVGVPDVTE 220
            |...||..:    :|.|..|.:             |||       ..:.:....|.:|...|:.:
Zfish    14 EPSFPPCEE----YHQNGYMPVSSDYYERPKDPGFPHHEEASYPRSNYQEQSYDYGNVSTNDLND 74

  Fly   221 VHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQ------GHPGQHTPPSQNPNSQSSGM 279
            ....||               |.||. :.|..||....:      |:..........|.||.|..
Zfish    75 FSDRHH---------------AQPQS-VSQNHGPRLTTESCVGSDGNKDCSLVSDALPGSQKSKE 123

  Fly   280 PSPLYPWMR---------SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALC 335
            | .:||||:         |..|...  ||.|..|||.|.||||||||||||||||||:||||.:|
Zfish   124 P-VVYPWMKKVHVNTVTASYSGGVP--KRSRTAYTRQQALELEKEFHFNRYLTRRRRVEIAHTMC 185

  Fly   336 LTERQIKIWFQNRRMKWKKENK 357
            |:|||:|||||||||||||::|
Zfish   186 LSERQVKIWFQNRRMKWKKDHK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/164 (22%)
Homeobox 301..354 CDD:395001 43/52 (83%)
hoxa4aNP_571610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..99 14/80 (18%)
Antp-type hexapeptide 126..131 3/4 (75%)
Homeobox 150..203 CDD:278475 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..245 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.