DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxa9b

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571608.1 Gene:hoxa9b / 58048 ZFINID:ZDB-GENE-000823-2 Length:258 Species:Danio rerio


Alignment Length:79 Identity:46/79 - (58%)
Similarity:57/79 - (72%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 SPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWF 345
            :||..|:.::    ..||: |..||::|||||||||.||.||:|.||.|:|..|.|||||:||||
Zfish   181 NPLSNWLHAK----STRKK-RCPYTKHQTLELEKEFLFNMYLSRDRRYEVARLLNLTERQVKIWF 240

  Fly   346 QNRRMKWKKENKTK 359
            ||||||.||.||.:
Zfish   241 QNRRMKMKKCNKDR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 7/24 (29%)
Homeobox 301..354 CDD:395001 37/52 (71%)
hoxa9bNP_571608.1 Hox9_act 1..174 CDD:282473
Homeobox 195..248 CDD:278475 37/53 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.