DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxb7a

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001108563.1 Gene:hoxb7a / 58044 ZFINID:ZDB-GENE-000329-2 Length:227 Species:Danio rerio


Alignment Length:221 Identity:97/221 - (43%)
Similarity:117/221 - (52%) Gaps:43/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 SCKLQAAVGGLGMVPEGGSPPLVDQMS----GHHMNAQMTLPHHMG-HPQA-QLGYTDVGVPDVT 219
            ||..|.| .|.|....|.  |:....|    ..:.|......|..| :|.| :||...:.:....
Zfish    35 SCSSQRA-SGYGSASTGA--PVSSSSSVSLPSMYTNGTSLSSHTQGMYPTAYELGAVSLNMHSSL 96

  Fly   220 EVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLY 284
            ..|.|            :|.|.|   |.:.:.|...:..|  .|.|   ..|.|:..      :|
Zfish    97 FDHPN------------LPMVSA---GDLCKAQSSGKEEQ--RGYH---QNNENNLR------IY 135

  Fly   285 PWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRR 349
            |||||...   :||||||||:|||||||||||||||||:||||||||||||||||||||||||||
Zfish   136 PWMRSTGA---DRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIAHALCLTERQIKIWFQNRR 197

  Fly   350 MKWKKENKT--KGEPGS---GGEGDE 370
            ||||||||:  :..|.:   ||:.:|
Zfish   198 MKWKKENKSTDRCSPAADQIGGDEEE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 42/150 (28%)
Homeobox 301..354 CDD:395001 50/52 (96%)
hoxb7aNP_001108563.1 Antp-type hexapeptide 134..139 3/4 (75%)
Homeobox 149..201 CDD:278475 49/51 (96%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..227 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm25055
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.