DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and CG34367

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:227 Identity:48/227 - (21%)
Similarity:78/227 - (34%) Gaps:65/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GHPQAQLGYTDVGV----------PDVT-------EVHQNHHNMGMYQQQSGVPP---------- 239
            |.....:..||:.|          |:.|       |.|...:::.....::.|.|          
  Fly    61 GEESVDIDITDLSVSESNTILAIDPEPTEESHSQREEHVETYSLSPTLHKAAVEPKPKNWLISED 125

  Fly   240 --VGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKC-------- 294
              |.:.|:        .|:|........|..:::.|:.......||.|      .:|        
  Fly   126 LDVDSQPE--------DPKMSGLPTASITECTEDSNTPKLAPDKPLLP------EECVSPEPSRN 176

  Fly   295 -------------QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQ 346
                         .:::|.|..:|..|..|||:.|....|.....|.|::..|.|:|.::::|||
  Fly   177 REHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQ 241

  Fly   347 NRRMKWKK-ENKTKGEPGSGGEGDEITPPNSP 377
            |||.|.:| ||:.......|.....|..|..|
  Fly   242 NRRAKCRKHENQMHKGFLVGSRSPPIATPLEP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 22/153 (14%)
Homeodomain 298..354 CDD:459649 21/55 (38%)
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 21/55 (38%)
OAR 392..410 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.