DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Drgx

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:131 Identity:39/131 - (29%)
Similarity:62/131 - (47%) Gaps:24/131 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QGPPQMHQGHP-GQHTP---------PSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTR 306
            |.||.:   || |.|.|         .:.:|.:..|     .:|.:..:....::::|.|.|:|.
  Fly     5 QCPPAL---HPCGPHPPRLPTLDYPFAATHPYTSYS-----YHPAIHDETFVRRKQRRNRTTFTL 61

  Fly   307 YQTLELEKEF---HFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEG 368
            .|..|||..|   |:....||.   ::|..:.|||.::::||||||.||:|..:.|.|......|
  Fly    62 QQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQRKRENG 123

  Fly   369 D 369
            :
  Fly   124 E 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 14/63 (22%)
Homeodomain 298..354 CDD:459649 24/58 (41%)
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 24/58 (41%)
OAR 428..446 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.