DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hmx2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001108570.3 Gene:hmx2 / 555632 ZFINID:ZDB-GENE-080506-2 Length:269 Species:Danio rerio


Alignment Length:160 Identity:46/160 - (28%)
Similarity:70/160 - (43%) Gaps:40/160 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 TDVGVPDVTEVHQNHH-----NMGMYQQQSGVP--PVGAP---PQGMMHQGQGPPQMHQGHPGQH 265
            ::.|||:....||..:     ..|:...|.|:.  |...|   |.....||:...||        
Zfish    69 SEPGVPESCNPHQPLNFCLGATKGLLPVQDGIDRRPHLTPSILPDYKEEQGRACSQM-------- 125

  Fly   266 TPPSQN-----PNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRR 325
            :|.|::     |:.|::                 ..:|:.|..::|.|..:||..|...|||:..
Zfish   126 SPVSEDRQRDGPDKQNN-----------------SAKKKTRTVFSRSQVYQLESTFDMKRYLSSS 173

  Fly   326 RRIEIAHALCLTERQIKIWFQNRRMKWKKE 355
            .|..:|.:|.|||.|:|.||||||.|||::
Zfish   174 ERACLASSLQLTETQVKTWFQNRRNKWKRQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 21/109 (19%)
Homeodomain 298..354 CDD:459649 26/55 (47%)
hmx2NP_001108570.3 Homeodomain 146..202 CDD:459649 26/55 (47%)

Return to query results.
Submit another query.