DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and crx

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001016021.1 Gene:crx / 548775 XenbaseID:XB-GENE-478452 Length:290 Species:Xenopus tropicalis


Alignment Length:159 Identity:36/159 - (22%)
Similarity:60/159 - (37%) Gaps:57/159 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 GMMHQGQGPPQMHQ--GHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQ 308
            |:...|.|...:|.  |:|   |.|                          ::::|.|.|:||.|
 Frog    14 GLTLAGTGMDLLHSAVGYP---TTP--------------------------RKQRRERTTFTRAQ 49

  Fly   309 TLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE------------------ 355
            ...||..|...||.....|.|:|..:.|.|.::::||:|||.|.:::                  
 Frog    50 LDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQSTGQAKPRPAKKKTS 114

  Fly   356 --NKTKGEPGSGGE------GDEITPPNS 376
              .:|..|..:.|:      |..:||.::
 Frog   115 PARETNSEASTNGQYSPPPPGTAVTPSST 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 11/61 (18%)
Homeodomain 298..354 CDD:459649 22/55 (40%)
crxNP_001016021.1 Homeodomain 39..94 CDD:459649 22/54 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..144 6/51 (12%)
TF_Otx 152..236 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.