DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa7

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001102703.2 Gene:Hoxa7 / 500126 RGDID:1587253 Length:229 Species:Rattus norvegicus


Alignment Length:165 Identity:78/165 - (47%)
Similarity:88/165 - (53%) Gaps:48/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 APPQGMMHQGQGPPQMHQGHPGQH---TPPSQNPNSQSSGMPSP--------------------- 282
            ||.......|.|........||.:   :|..|||.:.|.|:.:.                     
  Rat    32 APNSQRSGYGPGAGAFASNVPGLYNVNSPLYQNPFASSYGLGADAYNLPCASYDQNIPGLCSDLA 96

  Fly   283 ---------------------LYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRR 326
                                 :||||||   ...:||||||||||||||||||||||||||||||
  Rat    97 KGACDKADEGVLHGPAEASFRIYPWMRS---SGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRR 158

  Fly   327 RIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGE 361
            |||||||||||||||||||||||||||||:|.:.:
  Rat   159 RIEIAHALCLTERQIKIWFQNRRMKWKKEHKDESQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 26/108 (24%)
Homeobox 301..354 CDD:395001 52/52 (100%)
Hoxa7NP_001102703.2 Homeobox 133..185 CDD:278475 51/51 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.