| Sequence 1: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001040573.1 | Gene: | Lbx1 / 499362 | RGDID: | 1564197 | Length: | 285 | Species: | Rattus norvegicus |
| Alignment Length: | 132 | Identity: | 38/132 - (28%) |
|---|---|---|---|
| Similarity: | 54/132 - (40%) | Gaps: | 44/132 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 291 FGKCQ---ERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 352
Fly 353 KKE-------------------------------NKTKGEPGSGG----------EGDEITPPNS 376
Fly 377 PQ 378 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 5/17 (29%) |
| Homeodomain | 298..354 | CDD:459649 | 24/55 (44%) | ||
| Lbx1 | NP_001040573.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..36 | ||
| Homeodomain | 126..182 | CDD:459649 | 24/55 (44%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 212..285 | 9/36 (25%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||