DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Lbx1

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001040573.1 Gene:Lbx1 / 499362 RGDID:1564197 Length:285 Species:Rattus norvegicus


Alignment Length:132 Identity:38/132 - (28%)
Similarity:54/132 - (40%) Gaps:44/132 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 FGKCQ---ERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 352
            ||:.|   :|::.|..:|.:|..||||.|.:.:||:...|.:||..|.||..|:..||||||.|.
  Rat   116 FGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKL 180

  Fly   353 KKE-------------------------------NKTKGEPGSGG----------EGDEITPPNS 376
            |::                               ::..|..|.||          .|....||.:
  Rat   181 KRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEASGGGGGGGGGGCGRAKSRPGSPALPPGA 245

  Fly   377 PQ 378
            ||
  Rat   246 PQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 5/17 (29%)
Homeodomain 298..354 CDD:459649 24/55 (44%)
Lbx1NP_001040573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Homeodomain 126..182 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..285 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.