DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb5

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001178854.1 Gene:Hoxb5 / 497987 RGDID:1562292 Length:269 Species:Rattus norvegicus


Alignment Length:357 Identity:110/357 - (30%)
Similarity:142/357 - (39%) Gaps:109/357 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYP---RFPPYDRMPYYNGQ 72
            |:|||.||:      .|.|| ||    ...|:.:|...::..|:...|   ....|.    ||..
  Rat     1 MSSYFVNSF------SGRYP-NG----PDYQLLNYGSGSSLSGSYRDPAAMHTGSYG----YNYN 50

  Fly    73 GMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQ 137
            |||..     .:|..:.||..|.|                            .:.::..|...|:
  Rat    51 GMDLS-----VNRSSASSSHFGAV----------------------------GESSRAFPASAQE 82

  Fly   138 QLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMG 202
              |:..|..             :||.|.:        ||  |.|..:..| |......:.|....
  Rat    83 --PRFRQAT-------------SSCSLSS--------PE--SLPCTNGDS-HGAKPSASSPSDQA 121

  Fly   203 HP-QAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHT 266
            .| .:...:|::.                 :..:...|..|..|      ...|.:.:..|    
  Rat   122 TPASSSANFTEID-----------------EASASSEPEEAASQ------LSSPSLARAQP---- 159

  Fly   267 PPSQNPNSQSSGMPSPLYPWMR----SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRR 327
            .|.....:...|....::||||    |......:.||.|..||||||||||||||||||||||||
  Rat   160 EPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRR 224

  Fly   328 IEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359
            |||||||||:|||||||||||||||||:||.|
  Rat   225 IEIAHALCLSERQIKIWFQNRRMKWKKDNKLK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 28/149 (19%)
Homeobox 301..354 CDD:395001 49/52 (94%)
Hoxb5NP_001178854.1 PRK07003 <67..>171 CDD:235906 24/184 (13%)
Homeobox 198..251 CDD:365835 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.