DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb6

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006247294.1 Gene:Hoxb6 / 497986 RGDID:1562142 Length:224 Species:Rattus norvegicus


Alignment Length:253 Identity:96/253 - (37%)
Similarity:115/253 - (45%) Gaps:76/253 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTE 220
            ||..||.: ::.:|.|.:...|.:.||      .|..|    |:..|..|      |.|      
  Rat    11 PVTLASGQ-ESFLGQLPLYSSGYADPL------RHYPA----PYGPGPGQ------DKG------ 52

  Fly   221 VHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHP-------------GQHTPPSQNP 272
                      :...|..||.|.      ..|:..|..:...|             |...||..:|
  Rat    53 ----------FAASSYYPPAGG------GYGRAAPCDYGPAPAFYREKDAACALSGADEPPPFHP 101

  Fly   273 NSQSSG---------------MPSPLYPWMR-------SQFGKCQERKRGRQTYTRYQTLELEKE 315
            ..:.|.               ..:|:||||:       |.||  ...:|||||||||||||||||
  Rat   102 EPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFG--PSGRRGRQTYTRYQTLELEKE 164

  Fly   316 FHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITP 373
            ||:|||||||||||||||||||||||||||||||||||||:|.........|.:|..|
  Rat   165 FHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 39/179 (22%)
Homeobox 301..354 CDD:395001 51/52 (98%)
Hoxb6XP_006247294.1 Homeobox 150..203 CDD:395001 51/52 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5512
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.