DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb7

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001017480.1 Gene:Hoxb7 / 497985 RGDID:1559918 Length:219 Species:Rattus norvegicus


Alignment Length:193 Identity:96/193 - (49%)
Similarity:106/193 - (54%) Gaps:41/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 HPQAQLGY-TDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQG-PPQMHQGHPGQH 265
            :|| :.|| ...|.|....|      .|:|....|:  .|....|:...|.| .|.....|   .
  Rat    37 NPQ-RPGYGAGPGAPFSASV------QGLYSGGGGM--AGQSAAGVYEAGYGLEPSSFNMH---C 89

  Fly   266 TPPSQNPNSQSSGMPSP-------------------LYPWMRSQFGKCQERKRGRQTYTRYQTLE 311
            .|..||.:....|.|:.                   :||||||   ...||||||||||||||||
  Rat    90 APFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMRS---SGTERKRGRQTYTRYQTLE 151

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGG----EGDE 370
            ||||||:||||||||||||||||||||||||||||||||||||||||.| ||:.|    |.||
  Rat   152 LEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTSG-PGTTGQDKAEADE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/123 (29%)
Homeobox 301..354 CDD:395001 51/52 (98%)
Hoxb7NP_001017480.1 Antp-type hexapeptide 126..131 3/4 (75%)
Homeobox 141..193 CDD:278475 50/51 (98%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..219 13/22 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5512
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - oto96913
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.870

Return to query results.
Submit another query.