DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and nkx2.2b

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001007783.2 Gene:nkx2.2b / 493627 ZFINID:ZDB-GENE-050217-3 Length:237 Species:Danio rerio


Alignment Length:101 Identity:36/101 - (35%)
Similarity:52/101 - (51%) Gaps:3/101 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 GHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTR 324
            ||  ::..||.:|...:..:.:.......|.....::||| |..:::.||.|||:.|...|||:.
Zfish    61 GH--KYPVPSASPEELNPELSADESVDRESSEDSGKKRKR-RILFSKTQTFELERRFRQQRYLSA 122

  Fly   325 RRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKG 360
            ..|..:|..|.||..|:||||||.|.|.|:....||
Zfish   123 PEREHLAKLLHLTPTQVKIWFQNHRYKVKRARAEKG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 10/45 (22%)
Homeodomain 298..354 CDD:459649 26/55 (47%)
nkx2.2bNP_001007783.2 Homeodomain 96..152 CDD:459649 27/56 (48%)

Return to query results.
Submit another query.