DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxc8a

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001005771.1 Gene:hoxc8a / 449648 ZFINID:ZDB-GENE-990415-114 Length:250 Species:Danio rerio


Alignment Length:224 Identity:85/224 - (37%)
Similarity:107/224 - (47%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 YASCKLQAAVG-------GLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVP 216
            |..|:...:|.       |.|....|...|      .||:   ....||        |.|.:..|
Zfish    23 YYDCRFPQSVARSHTLVYGHGAAAPGFQHP------SHHV---QDFFHH--------GTTGISNP 70

  Fly   217 DVTE------VHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQ 275
            ...:      .|.:......|:.....|..|...:..:.|.......:..:||:    .|...||
Zfish    71 GYQQNPCALACHGDATKFYGYEALPRQPLYGTQQEATLAQYPDCKSSNSTNPGE----GQGHLSQ 131

  Fly   276 SSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQ 340
            :|. ||.::||||..   ...|:.|||||:|||||||||||.||.||||:||||::|||.|||||
Zfish   132 NSS-PSLMFPWMRPH---APGRRNGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALSLTERQ 192

  Fly   341 IKIWFQNRRMKWKKENKTKGEPGSGGEGD 369
            :|||||||||||||||.....||..||.:
Zfish   193 VKIWFQNRRMKWKKENNKDKFPGQRGEAE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/157 (23%)
Homeobox 301..354 CDD:395001 44/52 (85%)
hoxc8aNP_001005771.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..152 13/47 (28%)
Antp-type hexapeptide. /evidence=ECO:0000255 138..143 2/4 (50%)
Homeobox 153..205 CDD:278475 43/51 (84%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..250 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.