DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxc8

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 / 448482 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis


Alignment Length:174 Identity:75/174 - (43%)
Similarity:94/174 - (54%) Gaps:33/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 HQNHH-------------NMGMYQQQSGVPPVG---------APPQGMMHQGQGPPQMHQGHP-- 262
            |.:||             |.|..|....:...|         |.|:..::..|....:.| :|  
 Frog    51 HPSHHVQEFFHHGSSSLSNSGFQQNPCALTCHGDASKFYGYEALPRQSLYGAQQEASVVQ-YPDC 114

  Fly   263 ----GQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLT 323
                ..:|...|...:|:|. ||.::||||..   ...|:.|||||:|||||||||||.||.|||
 Frog   115 KSSSNTNTSEGQGHLNQNSS-PSLMFPWMRPH---APGRRSGRQTYSRYQTLELEKEFLFNPYLT 175

  Fly   324 RRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE 367
            |:||||::|||.|||||:|||||||||||||||.....||:..|
 Frog   176 RKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 28/111 (25%)
Homeobox 301..354 CDD:395001 44/52 (85%)
hoxc8NP_001006787.1 Homeobox 153..206 CDD:365835 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4475
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.