DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and meox1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001002450.2 Gene:meox1 / 436723 ZFINID:ZDB-GENE-040718-149 Length:253 Species:Danio rerio


Alignment Length:261 Identity:76/261 - (29%)
Similarity:101/261 - (38%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 ASCKLQAAVGGL--GMV--PEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDV------- 213
            :||......||.  |.|  |..|.       ||..:......|..:......|.|||.       
Zfish     6 SSCMRSPHTGGALWGCVRSPHSGG-------SGAGIQPYQQAPFALHQKHDFLAYTDFSSSCLVP 63

  Fly   214 ---GVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQ------------------- 256
               ..|....::...|: |..:.:....|  ..|:|   :||.|.|                   
Zfish    64 APHAYPREDRLYPETHS-GYQRTEWQFSP--CEPRG---RGQEPCQGAAEAVGAEMDSAGGDRLA 122

  Fly   257 -----MHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQF---GKCQERKRGRQTYTRYQTLELE 313
                 ..:|.....:.|:.:...:||.....:.....|.|   ..|:.||. |..:|:.|..|||
Zfish   123 GAVTGCLEGDYSPQSVPAVDTEKKSSKRKREVTDIQDSSFKADSNCKARKE-RTAFTKEQLRELE 186

  Fly   314 KEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGG--EGDEITPPNS 376
            .||..:.||||.||.|||..|.|||||:|:||||||||||:..  .|:|.|..  |.||:....|
Zfish   187 AEFTHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVK--GGQPASPHDLEADELDSAAS 249

  Fly   377 P 377
            |
Zfish   250 P 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/185 (19%)
Homeobox 301..354 CDD:395001 33/52 (63%)
meox1NP_001002450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..158 3/21 (14%)
Homeobox 174..226 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.