DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and ro

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:310 Identity:87/310 - (28%)
Similarity:121/310 - (39%) Gaps:86/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 QQHQV-YSRPD-SPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQL- 139
            |:|:| ...|| ||..:....:........|.||       |:||          :|:|..::| 
  Fly     2 QRHKVEIGSPDGSPGIKRSDSLDPIANTTILSVP-------QRPS----------SPRQFFERLY 49

  Fly   140 ------PQVTQQV---THPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQM 195
                  .....::   ||..:.......|.|              :|||....|........:..
  Fly    50 GHLETRSSENGEIDVGTHAHKPPPCDTPYHS--------------DGGSVSSPDISISDERTSLA 100

  Fly   196 TLP------HHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQG--- 251
            ..|      |...:||           ..::.||.||:...:           ||| ::||.   
  Fly   101 AYPAYDFYGHAKDYPQ-----------HPSQQHQQHHHHHHH-----------PPQ-LVHQKLSY 142

  Fly   252 -QGPPQMHQGHPGQHTPPSQNPNSQSSGMPS-PLYPWMRSQFGKCQERKRGRQ-----TYTRYQT 309
             ..||.:..|  |...|..  |::..:|.|| |.:....|.|...:.||.|||     |::..||
  Fly   143 VSPPPAIAAG--GAANPVL--PHAFPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQRTTFSTEQT 203

  Fly   310 LELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359
            |.||.|||.|.|::|.||.|:|..|.|||.||||||||||.|.|:..|.:
  Fly   204 LRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/160 (23%)
Homeobox 301..354 CDD:395001 33/57 (58%)
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.