DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and MEOX2

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_005915.2 Gene:MEOX2 / 4223 HGNCID:7014 Length:304 Species:Homo sapiens


Alignment Length:280 Identity:75/280 - (26%)
Similarity:103/280 - (36%) Gaps:80/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGH-HMNAQMTLPHHMGH 203
            |..|.|..||..|       :|..|......:. .||..:......::|: :........||.||
Human    12 PHATAQGLHPFSQ-------SSLALHGRSDHMS-YPELSTSSSSCIIAGYPNEEGMFASQHHRGH 68

  Fly   204 PQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQS--------GVPPVGAPPQGMMH------QGQGP 254
            ..                |.:||:...:|||.        .:|.:.:||....|      ...||
Human    69 HH----------------HHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGP 117

  Fly   255 PQMHQGHPGQHTPPSQNPNSQSSGMPSPL------YPWMRSQFGKCQERKRG------------- 300
            |::..      :||....||.|.|..:|.      ..:.|......:..||.             
Human   118 PELGS------SPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQE 176

  Fly   301 --------------RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 351
                          |..:|:.|..|||.||..:.||||.||.|||..|.|||||:|:||||||||
Human   177 GNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK 241

  Fly   352 WKKENKTKGEPGSGGEGDEI 371
            ||:..  .|:.|:.....|:
Human   242 WKRVK--GGQQGAAAREKEL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/192 (17%)
Homeobox 301..354 CDD:395001 33/52 (63%)
MEOX2NP_005915.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..192 27/150 (18%)
COG5576 160..284 CDD:227863 39/102 (38%)
Homeobox 191..243 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.