DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Ubx

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:251 Identity:88/251 - (35%)
Similarity:100/251 - (39%) Gaps:100/251 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTE 220
            ||..::|...:.|||. :...||||                :.|..|.....:           .
  Fly   152 PVRPSACTPDSRVGGY-LDTSGGSP----------------VSHRGGSAGGNV-----------S 188

  Fly   221 VHQNHHNMGMYQQQSGVPPVGAPP--------QGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSS 277
            |...:.|.|  ..||||...||..        .|...|......:||.  ..||           
  Fly   189 VSGGNGNAG--GVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQA--SNHT----------- 238

  Fly   278 GMPSPLYPWMRSQFGKCQE-------------------------------------------RKR 299
                 .|||| :..|:|.|                                           |:|
  Fly   239 -----FYPWM-AIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRR 297

  Fly   300 GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 355
            ||||||||||||||||||.|.|||||||||:|||||||||||||||||||||.|||
  Fly   298 GRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 39/195 (20%)
Homeobox 301..354 CDD:395001 48/52 (92%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D544833at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.