DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Antp and LMX1A

DIOPT Version :9

Sequence 1:	NP_996167.1	Gene:	Antp / 40835	FlyBaseID:	FBgn0260642	Length:	378	Species:	Drosophila melanogaster
Sequence 2:	NP_001167540.1	Gene:	LMX1A / 4009	HGNCID:	6653	Length:	382	Species:	Homo sapiens

Alignment Length:	134	Identity:	32/134 - (23%)
Similarity:	46/134 - (34%)	Gaps:	48/134 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly   292 GKCQER-KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK- 354
            ||..:| ||.|...|..|....:..|..:....|:.|..:|....|:.|.:::||||:|.|.||
Human   189 GKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253

  Fly   355 -----------EN-------KTKGEPGSGGEG----------------------------DEITP 373
                       :|       :|.|...:|.||                            ..:||
Human   254 ARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTP 318

  Fly   374 PNSP 377
            |..|
Human   319 PQMP 322

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Antp	NP_996167.1	KLF1_2_4_N	<161..306	CDD:425360	6/14 (43%)
Antp	NP_996167.1	Homeobox	301..354	CDD:395001	15/52 (29%)
LMX1A	NP_001167540.1	LIM1_Lmx1a	35..86	CDD:188756
		LIM2_Lmx1a_Lmx1b	94..148	CDD:188764
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	161..208		8/18 (44%)
		Homeobox	198..252	CDD:395001	15/53 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	252..285		5/32 (16%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R3844
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.030