powered by:
Protein Alignment Antp and LMX1A
DIOPT Version :9
Sequence 1: | NP_996167.1 |
Gene: | Antp / 40835 |
FlyBaseID: | FBgn0260642 |
Length: | 378 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001167540.1 |
Gene: | LMX1A / 4009 |
HGNCID: | 6653 |
Length: | 382 |
Species: | Homo sapiens |
Alignment Length: | 134 |
Identity: | 32/134 - (23%) |
Similarity: | 46/134 - (34%) |
Gaps: | 48/134 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 292 GKCQER-KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK- 354
||..:| ||.|...|..|....:..|..:....|:.|..:|....|:.|.:::||||:|.|.||
Human 189 GKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKL 253
Fly 355 -----------EN-------KTKGEPGSGGEG----------------------------DEITP 373
:| :|.|...:|.|| ..:||
Human 254 ARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTP 318
Fly 374 PNSP 377
|..|
Human 319 PQMP 322
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3844 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.