powered by:
Protein Alignment Antp and CG4328
DIOPT Version :9
Sequence 1: | NP_996167.1 |
Gene: | Antp / 40835 |
FlyBaseID: | FBgn0260642 |
Length: | 378 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648567.2 |
Gene: | CG4328 / 39405 |
FlyBaseID: | FBgn0036274 |
Length: | 544 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 25/73 - (34%) |
Similarity: | 35/73 - (47%) |
Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 298 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK-ENKTKGE 361
||.|......|....:..|..:....|:.|..:|....|:.|.:::||||:|.|.|| :.|.|.|
Fly 342 KRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQE 406
Fly 362 PGSGGEGD 369
|.|.|..|
Fly 407 PPSKGASD 414
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
45 |
1.000 |
Domainoid score |
I3555 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3844 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.