DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and CG4328

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster


Alignment Length:73 Identity:25/73 - (34%)
Similarity:35/73 - (47%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK-ENKTKGE 361
            ||.|......|....:..|..:....|:.|..:|....|:.|.:::||||:|.|.|| :.|.|.|
  Fly   342 KRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQE 406

  Fly   362 PGSGGEGD 369
            |.|.|..|
  Fly   407 PPSKGASD 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 3/7 (43%)
Homeodomain 298..354 CDD:459649 16/55 (29%)
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757
LIM 259..313 CDD:413332
COG5576 <332..439 CDD:227863 25/73 (34%)
HOX 341..393 CDD:197696 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.