DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and CG4328

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster


Alignment Length:73 Identity:25/73 - (34%)
Similarity:35/73 - (47%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK-ENKTKGE 361
            ||.|......|....:..|..:....|:.|..:|....|:.|.:::||||:|.|.|| :.|.|.|
  Fly   342 KRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQE 406

  Fly   362 PGSGGEGD 369
            |.|.|..|
  Fly   407 PPSKGASD 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 3/7 (43%)
Homeobox 301..354 CDD:395001 14/52 (27%)
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757
LIM 259..313 CDD:295319
COG5576 <332..439 CDD:227863 25/73 (34%)
HOX 341..393 CDD:197696 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.